PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_27823_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 286aa    MW: 31294.2 Da    PI: 8.3171
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_27823_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.42.2e-163879142
             TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                    k+++gC+Ckk+ Clk+YCeCf+a++ Cs++CkC dCkN+ee+
  Neem_27823_f_1 38 KHNWGCRCKKTGCLKNYCECFHAKVSCSKNCKCMDCKNSEEH 79
                    5899***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163422.473178IPR005172CRC domain
SMARTSM011141.5E-153879IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-124176IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MESILQRNPN AFRPKIPTSP SNAQDNVDDA KDNSMVGKHN WGCRCKKTGC LKNYCECFHA  60
KVSCSKNCKC MDCKNSEEHQ EKVALPGRDY NSTKIFNNYE GYKKSVAVAG GGNTNTNISK  120
NFEGSKEREA ITNADHGEPN ICKNFEGHKE AMACPRRVNN QASICIKQAN AAASAAIGFS  180
DSSIIQASRK RKLQEFLDLN EKDAPIQKLK NRIEEEETSG VNPLRVYSSL SALSVGPVGN  240
VGNASILNPK EFQCSARSSF AEQDVEQLCS LLVLASEAAK KVLGTY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.19e-29Tesmin/TSO1-like CXC domain-containing protein